toonpool logo
  • Agent
  • Collections
  • more
    • Community
    • Members
    • Pro search
    • Help
  • Log In




    • Password lost?
  • Register
  • english
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Newest cartoons
Cartoon: Biologische Lebensmittel (medium) by wista tagged bio,biolebensmittel,lebensmittel,biologischer,anbau,gene,genfrei,gentechnik,kontrollierter,kontrolle,joghurt,früchte,gemüse,gesund,health,claim,landwirtschaft,nachhaltig,geschmack,vitamine,mineralstoffe,astaxanthin,lycopin,lutein,zeaxanthin,fettsäuren,omega,birne,milch,milchprodukte,apfel,glas,gläser,konservierungsstoffe,frei

Biologische Lebensmittel

#310866 / viewed 5433 times
wista By wista
on March 12, 2018
rating-star 2
Applause
favorite
Favorite
report spam
Report

2018

Media & Culture »  Gastronomy  Bars & Pubs  Nutrition  Education  Society  Family & Youth  Consumption  Traditions  Lifestyle

biobiolebensmittellebensmittelbiologischeranbaugenegenfreigentechnikkontrollierterkontrollejoghurtfrüchtegemüsegesundhealthclaimlandwirtschaftnachhaltiggeschmackvitaminemineralstoffeastaxanthinlycopinluteinzeaxanthinfettsäurenomegabirnemilchmilchprodukteapfelglasgläserkonservierungsstoffefrei

Comments (0)

Add comment  
 

More of wista


Cartoon: Nikolaus (small) by wista tagged sankt,nikolaus,christkind,weihnachtsmann,dezember,kinder,geschenk,geschenke,alle,brav,heilige,heilig,kirche,sack
Nikolaus
Cartoon: Coronafrösche (small) by wista tagged corona,covid,pandemie,maske,masken,ffp2,frosch,frösche,storch,essen,trinken,retaurant,test,testen,2g,3g,schutzmaske,kneipe,pcr,antigen
Coronafrösche
Cartoon: SPD-Parteivorsitz (small) by wista tagged politik,spd,partei,vorsitzender,vorsitz,parteivorsitzender,parteivorsitzende,mobbing,aufgabe,abdanken,rot,links,linke,nahles,andrea,gabriel,sigmar,müntefering,franz,kurt,beck,scharping,rudolf,schröder,lafontaine,brandt,willy,aufgeben,verzciht,wahl,abwahl,scholtz,olaf,politiker,umgang,umgangsform
SPD-Parteivorsitz
  • Service

  • ToonAgent
  • Help
  • FAQ
  • Daily Toon
  • About Us

  • About Us
  • Contact
  • Terms of Use
  • Privacy Policy
  • Manage cookies
  • Community

  • Community
  • Pro search
  • Collections
  • Register
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie settings

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.