toonpool logo
  • Agent
  • Collections
  • more
    • Community
    • Members
    • Pro search
    • Help
  • Log In




    • Password lost?
  • Register
  • english
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Newest cartoons
Cartoon: Kürbisgeschnetzeltes (medium) by RABE tagged reformation,reformationstag,luther,martin,oktober,evangelisch,kirche,pfarrer,feiertag,thesen,wittenberg,stadttor,kloster,christ,durcheinander,kürbis,kürbissuppe,halloween,druiden,kelten,allerheiligen,irland,samhainfest,mönch,ablass,süsse,saures,verkleidung,masken,halloweenmaske,reformation,luther,reformationstag,martin,oktober,evangelisch,kirche,pfarrer,feiertag,wittenberg

Kürbisgeschnetzeltes

#148301 / viewed 8755 times
RABE By RABE
on October 28, 2011
rating-star 8
Applause
favorite
Favorite
report spam
Report

Ohne Worte

Religion »  Church  Belief  Christianity  Jesus Christ  Pope  Devil & Hell  God & Heaven  Holidays  Bible  Adam & Eve

reformationreformationstagluthermartinoktoberevangelischkirchepfarrerfeiertagthesenwittenbergstadttorklosterchristdurcheinanderkürbiskürbissuppehalloweendruidenkeltenallerheiligenirlandsamhainfestmönchablasssüssesauresverkleidungmaskenhalloweenmaskereformationlutherreformationstagmartinoktoberevangelischkirchepfarrerfeiertagwittenberg

Comments (4)

 
manfredw
Member
Hat da nicht einer in Wittenberg seinen Kürbis an die Tür gehauen?

manfredw, on October 29, 2011  report post  reply applause 0

 
zenundsenf
Member
nö, war früher mal reformationstag!:)
*****

zenundsenf, on October 28, 2011  report post  reply applause 0

 
Erl
Member
... oder gut kombiniert!

Erl, on October 28, 2011  report post  reply applause 0

 
Harm Bengen
Member
dass die bälger im religionsunterricht auch nie aufpassen... ts, ts...

Harm Bengen, on October 28, 2011  report post  reply applause 0

 
 

Add comment
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

More of RABE


Cartoon: Rauchzeichen (small) by RABE tagged trump,usa,president,bolton,literatur,bücher,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,corona,biden,harris,wiederwahl,briefwahl,wahlmänner,sanduhr,sand,abwahl,joe,demokraten,republikaner,abwahlverfahren,capitol,kapitol,erstürmung,qanons,washington,bürgerkrig,hörnermann,senat,rauchzeichen,fahne,decke,qualm
Rauchzeichen
Cartoon: Kochsalz für alle (small) by RABE tagged ampel,ampelregierung,rot,grün,gelb,fdp,spd,grüne,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,inflation,einkommen,rente,rentenpaket,bruch,streit,neuwahlen,karl,lauterbach,kochsalz,kochsalzlösung,engpass,nobelpreis,chemie,schweden,akademie,stockholm,protein
Kochsalz für alle
Cartoon: Prima Klima (small) by RABE tagged klimawandel,umwelt,umweltministerin,schulze,sp,klimapreis,heizung,auto,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,brücke,bettler,verkehr,klimaprämie,friday,for,future,thunberg,katar,doha,hauptstadt,arabische,emirate,leichtathletik,weltmwisterschaft,stadion,wettkampfstadion,temperaturen,hitze,khalifa,sport
Prima Klima
  • Service

  • ToonAgent
  • Help
  • FAQ
  • Daily Toon
  • About Us

  • About Us
  • Contact
  • Terms of Use
  • Privacy Policy
  • Manage cookies
  • Community

  • Community
  • Pro search
  • Collections
  • Register
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie settings

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.