toonpool logo
  • Agent
  • Collections
  • more
    • Community
    • Members
    • Pro search
    • Help
  • Log In




    • Password lost?
  • Register
  • english
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Newest cartoons
Cartoon: Haare in der Suppe (medium) by RABE tagged merz,union,kanzler,fritze,koalition,spd,klingbeil,bundesregierung,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,trump,putin,krisen,tv,nachrichten,waschmaschine,frieden,friedensplan,us,usa,eu,europa,entschärfung,kiew,russland,ukraine,selenskyj,ober,kellner,suppe,haare,beschwerdebuch,merz,union,kanzler,fritze,koalition,spd,klingbeil,bundesregierung,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,trump,putin,krisen,tv,nachrichten,waschmaschine,frieden,friedensplan,us,usa,eu,europa,entschärfung,kiew,russland,ukraine,selenskyj,ober,kellner,suppe,haare,beschwerdebuch

Haare in der Suppe

#474523 / viewed 922 times
RABE By RABE
on November 25, 2025
rating-star 3
Applause
favorite
Favorite
report spam
Report

Ohne Worte

Politics »  National/Domestic  International  Elections  Taxes  Finances  Pension  Economy & Money  Technology  Environment  Health  Family & Youth  Education  Confederations  Jobs & Social  Immigration  Fraud & Corruption  Historical  Other  Conflicts & War  Politicians  Parties  Democracy

merzunionkanzlerfritzekoalitionspdklingbeilbundesregierungraberalfböhmecartoonkarikaturpressezeichnungfarbcartoontagescartoontrumpputinkrisentvnachrichtenwaschmaschinefriedenfriedensplanususaeueuropaentschärfungkiewrusslandukraineselenskyjoberkellnersuppehaarebeschwerdebuchmerzunionkanzlerfritzekoalitionspdklingbeilbundesregierungraberalfböhmecartoonkarikaturpressezeichnungfarbcartoontagescartoontrumpputinkrisentvnachrichtenwaschmaschinefriedenfriedensplanususaeueuropaentschärfungkiewrusslandukraineselenskyjoberkellnersuppehaarebeschwerdebuch

Comments (3)

 
Erl
Member
Blonde?

Erl, on November 28, 2025  report post  reply applause 0

 
Harm Bengen
Member
toupet-terrine.

Harm Bengen, on November 25, 2025  report post  reply applause 0

 
KI-Vossy
Member
das ist ja auch eine haarige suppe!

KI-Vossy, on November 25, 2025  report post  reply applause 0

 
 

Add comment
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

More of RABE


Cartoon: Retortenburger (small) by RABE tagged burger,retortenburger,gewebe,gewebezüchterei,metzgerei,metzger,fleischer,fleischerei,fleisch,enzyme,labor,wissenschaftler,reagenzglas,stammzellen,rinderstammzellen,fleischklops,niederlande,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,wurs
Retortenburger
Cartoon: Eine Kreuzfahrt die ist lustig (small) by RABE tagged virus,corona,pandemie,coronakrise,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,viren,virenschutz,mundschutz,desinfektion,föderal,föderalismus,ländersache,tourismus,lockerungen,beschränkungen,tourismusbranche,reisebranche,mittelmeer,mittelmeerkreuzfahrt,kreuzfahrten,camping,campinganhänger,reisefieber
Eine Kreuzfahrt die ist lustig
Cartoon: Flammendes Inferno (small) by RABE tagged usa,trump,washington,unruhen,mord,gewalt,polizei,george,floyd,proteste,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,afroamerikaner,polizeieinsatz,ausgangssperre,protest,cnn,ausschreitungen,minneapolis,rassismus,plünderungen,linksradikale
Flammendes Inferno
  • Service

  • ToonAgent
  • Help
  • FAQ
  • Daily Toon
  • About Us

  • About Us
  • Contact
  • Terms of Use
  • Privacy Policy
  • Manage cookies
  • Community

  • Community
  • Pro search
  • Collections
  • Register
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie settings

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.