toonpool logo
  • Agent
  • Collections
  • more
    • Community
    • Members
    • Pro search
    • Help
  • Log In




    • Password lost?
  • Register
  • english
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Newest cartoons
Cartoon: Lebkuchenstand (medium) by RABE tagged merz,kanzler,koalition,union,spd,klingbeil,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,haushalt,schulden,rente,feuerwehr,lebkuchen,lebkuchenstand,weihnachtsmarkt,weihnachten,pfefferkuchen,rettungsgasse,gaffer,merz,kanzler,koalition,union,spd,klingbeil,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,haushalt,schulden,rente,feuerwehr,lebkuchen,lebkuchenstand,weihnachtsmarkt,weihnachten,pfefferkuchen,rettungsgasse,gaffer

Lebkuchenstand

#475859 / viewed 1165 times
RABE By RABE
on December 21, 2025
rating-star 5
Applause
favorite
Favorite
report spam
Report

Ohne Worte

Politics »  National/Domestic  Elections  Taxes  Finances  Pension  Economy & Money  Technology  Environment  Health  Family & Youth  Education  Confederations  Jobs & Social  Immigration  Fraud & Corruption  Historical  Other  Politicians  Parties  Democracy

merzkanzlerkoalitionunionspdklingbeilcartoonkarikaturpressezeichnungfarbcartoontagescartoonhaushaltschuldenrentefeuerwehrlebkuchenlebkuchenstandweihnachtsmarktweihnachtenpfefferkuchenrettungsgassegaffermerzkanzlerkoalitionunionspdklingbeilcartoonkarikaturpressezeichnungfarbcartoontagescartoonhaushaltschuldenrentefeuerwehrlebkuchenlebkuchenstandweihnachtsmarktweihnachtenpfefferkuchenrettungsgassegaffer

Comments (5)

 
Erl
Member
Was für´s Herz.

Erl, on December 21, 2025  report post  reply applause 0

 
Harm Bengen
Member
lebkuchen statt sterbkuchen.

Harm Bengen, on December 21, 2025  report post  reply applause 0

 
MorituruS
Member
ArtyFicial wrote:
So wahr. Immerhin. "Mutti ist die Beste", hat A.M. dagegen stets falsch interpretiert.
Wer ist A.M.?

MorituruS, on December 21, 2025  report post  reply applause 0

 
ArtyFicial
Member
So wahr. Immerhin. "Mutti ist die Beste", hat A.M. dagegen stets falsch interpretiert.

ArtyFicial, on December 21, 2025  report post  reply applause 0

 
Guest Avatar
Deleted
Eigentlich traurig.

, on December 21, 2025  report post  reply applause 0

 
 

Add comment
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

More of RABE


Cartoon: Merkelbrief (small) by RABE tagged merkelbrief
Merkelbrief
Cartoon: Retortenburger (small) by RABE tagged burger,retortenburger,gewebe,gewebezüchterei,metzgerei,metzger,fleischer,fleischerei,fleisch,enzyme,labor,wissenschaftler,reagenzglas,stammzellen,rinderstammzellen,fleischklops,niederlande,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,wurs
Retortenburger
Cartoon: Heizungsgesetz (small) by RABE tagged merz,kanzler,koalition,union,spd,klingbeil,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,bürokratie,verwaltung,beamte,modernisierung,monster,drachen,schwert,holzschwert,nägel,säge,heizung,heizungsgesetz,habeck,ampel,knoten,thermostat,schwarz,rot
Heizungsgesetz
  • Service

  • ToonAgent
  • Help
  • FAQ
  • Daily Toon
  • About Us

  • About Us
  • Contact
  • Terms of Use
  • Privacy Policy
  • Manage cookies
  • Community

  • Community
  • Pro search
  • Collections
  • Register
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie settings

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.