toonpool logo
  • Agent
  • Collections
  • more
    • Community
    • Members
    • Pro search
    • Help
  • Log In




    • Password lost?
  • Register
  • english
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Newest cartoons
Cartoon: Pflegewarntag (medium) by KI-Vossy tagged pflege,deutschland,gesundheitssystem,pflegeheime,lauterbach,gesundheitsminister,alarm,alarmstimmung,pflegeplatz,strafzinsen,agvp,politik,pflegesystem,pflegekrise,probewarnung,pflegegesetz,spd,cdu,politiker,ampel,karikatur,pflege,deutschland,gesundheitssystem,pflegeheime,lauterbach,gesundheitsminister,alarm,alarmstimmung,pflegeplatz,strafzinsen,agvp,politik,pflegesystem,pflegekrise,probewarnung,pflegegesetz,spd,cdu,politiker,ampel,karikatur

Pflegewarntag

#450044 / viewed 2155 times
KI-Vossy By KI-Vossy
on September 13, 2024
rating-star 1
Applause
favorite
Favorite
report spam
Report

Warnung auf höchster Stufe – PROBEWARNUNG, BUNDESWEITER WARNTAG: Akutes Heimsterben bedroht Deutschland!

In den vergangenen 18 Monaten warfen über 1.000 Pflegeanbieter das Handtuch. Und das, obwohl die Anzahl der Menschen, die Pflege benötigen, immer weiter zunimmt. https://www.merkur.de/wirtschaft/heimsterbens-in-deutschland-agvp-praesident-verlangt-stopp-von-lauterbachs-irrweg-angesichts-des-massiven-93285139.html

Deutschland stecke in einer schweren Pflegekrise, und Lauterbachs Irrweg müsse gestoppt werden, fordert der Präsident des Arbeitgeberverbands Pflege (AGVP), Thomas Greiner. Das Pflegesystem braucht eine verlässlichere Politik, um stabile Rahmenbedingungen für Einrichtungen zu garantieren.

Aber „die Kassen und Bundesländer kommen ihrer gesetzlichen Pflicht nicht nach, die Versorgung der alten Menschen sicherzustellen“, erklärt der AGVP-Präsident.

Strafzinsen könnten Druck auf säumige Kostenträger ausüben. Außerdem sollen pflegebedürftige Menschen und ihre Angehörigen Schadensersatzansprüche gegenüber den Kostenträgern geltend machen können und einen Rechtsanspruch auf einen Pflegeplatz erhalten.

Alarmstimmung auch ganz ohne Alarm!

Politics »  National/Domestic  Taxes  Finances  Pension  Economy & Money  Technology  Family & Youth  Confederations  Jobs & Social  Historical  Other  Politicians  Parties  Privacy & Customer  Democracy

pflegedeutschlandgesundheitssystempflegeheimelauterbachgesundheitsministeralarmalarmstimmungpflegeplatzstrafzinsenagvppolitikpflegesystempflegekriseprobewarnungpflegegesetzspdcdupolitikerampelkarikaturpflegedeutschlandgesundheitssystempflegeheimelauterbachgesundheitsministeralarmalarmstimmungpflegeplatzstrafzinsenagvppolitikpflegesystempflegekriseprobewarnungpflegegesetzspdcdupolitikerampelkarikatur

Comments (0)

Add comment  
 

Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

More of KI-Vossy


Cartoon: Don the Decorator (small) by KI-Vossy tagged republikaner,hakenkreuz,taylor,flagge,usa,washington,trump,republicans,meeting,flag,us,swastika,motif,republican,cross,right,wing,politiker,weiße,haus,decoration,decorations,decorator,paint,brown,potus
Don the Decorator
Cartoon: Der Egogipfel (small) by KI-Vossy tagged scholz,habeck,lindner,bundeskanzler,deutschland,gipfel,loriot,kanzler,minister,politik,halloween
Der Egogipfel
Cartoon: KI Witz (small) by KI-Vossy tagged joke,jokes,funny,ai,caricature,caricatures,creative,creativity,algorithm,algorithms,incompetence,incompetent,dilemma,humor,humorless,caricaturist,ki,künstliche,intelligenz,karikaturist,karikatur,algorithmen,algorithmus,zeichnen,inkompetenz,kompetenz,witz
KI Witz
  • Service

  • ToonAgent
  • Help
  • FAQ
  • Daily Toon
  • About Us

  • About Us
  • Contact
  • Terms of Use
  • Privacy Policy
  • Manage cookies
  • Community

  • Community
  • Pro search
  • Collections
  • Register
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie settings

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.