toonpool logo
  • Agent
  • Collections
  • more
    • Community
    • Members
    • Pro search
    • Help
  • Log In




    • Password lost?
  • Register
  • english
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Newest cartoons
Cartoon: Regierungs-Wünsche (medium) by Mirco Tomicek tagged wirtschaft,wirtschaftsgespräche,öl,gas,energien,energie,rüstung,rüstungsexporte,friedrich,merz,kanzler,reise,reist,golfregion,saudi,arabien,katar,karikatur,pressekarikatur,cartoon,mirco,tomicek,wirtschaft,wirtschaftsgespräche,öl,gas,energien,energie,rüstung,rüstungsexporte,friedrich,merz,kanzler,reise,reist,golfregion,saudi,arabien,katar,karikatur,pressekarikatur,cartoon,mirco,tomicek

Regierungs-Wünsche

#478397 / viewed 1751 times
Mirco Tomicek By Mirco Tomicek
on February 04, 2026
rating-star 1
Applause
favorite
Favorite
report spam
Report

Wirtschaftsgespräche:
Bundeskanzler Merz reist in die Golfregion.

Politics »  National/Domestic  International  Military & Security  Finances  Economy & Money  Technology  Family & Youth  Confederations  Jobs & Social  Other  Conflicts & War  Politicians  Parties  Privacy & Customer  Democracy  Energy

wirtschaftwirtschaftsgesprächeölgasenergienenergierüstungrüstungsexportefriedrichmerzkanzlerreisereistgolfregionsaudiarabienkatarkarikaturpressekarikaturcartoonmircotomicekwirtschaftwirtschaftsgesprächeölgasenergienenergierüstungrüstungsexportefriedrichmerzkanzlerreisereistgolfregionsaudiarabienkatarkarikaturpressekarikaturcartoonmircotomicek

Comments (1)

 
ArtyFicial
Member
Sehr schön!

ArtyFicial, on February 04, 2026  report post  reply applause 0

 
 

Add comment
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

More of Mirco Tomicek


Cartoon: Kopfball (small) by Mirco Tomicek tagged klimabilanz,klimaziele,klima,ziel,ziele,2020,emission,klimaschutz,klimaschutzziele,umweltbundesamt,klimaschutzgesetz,co2,austoß,treibhausgase,treibhaus,svenja,schulze,spd,erwärmung,erde,erderwärmung,umweltbilanz,einhalten,einhaltung,natur,naturschutz,umwelt,umweltschutz,corona,covid19,lockdown,shutdown,lockdowns,pandemie,cartoon,karikatur,pressekarikatur,mirco,tomicek
Kopfball
Cartoon: Der große Wurf? (small) by Mirco Tomicek tagged eu,vertrag,europa,pharma,pharmafirma,impfstoff,impfung,impfen,corona,covid19,impfungen,risiko,risikogruppen,medizin,arzt,ärzte,verträge,biontech,pfizer,kommission,einigung,antivirus,viren,bekämpfung,cartoon,karikatur,pressekarikatur,mirco,tomicek
Der große Wurf?
Cartoon: Fit For Ostern (small) by Mirco Tomicek tagged ostern,ostereiersuche,eiersuche,eier,ostereier,suche,osterhase,hase,eiweißpulver,eiweiß,protein,fit,fitness,sport,gym,kraftsport,training,whey,proteine,cartoon,karikatur,pressekarikatur,mirco,tomicek
Fit For Ostern
  • Service

  • ToonAgent
  • Help
  • FAQ
  • Daily Toon
  • About Us

  • About Us
  • Contact
  • Terms of Use
  • Privacy Policy
  • Manage cookies
  • Community

  • Community
  • Pro search
  • Collections
  • Register
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie settings

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.