toonpool logo
  • Agent
  • Collections
  • more
    • Community
    • Members
    • Pro search
    • Help
  • Log In




    • Password lost?
  • Register
  • english
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Newest cartoons
Cartoon: Toilet (medium) by Enrico Bertuccioli tagged meta,markzuckerberg,elonmusk,socialmedia,censorship,freespeech,fakenews,internet,money,business,monopoly,capitalism,neocapitalism,digitaldevices,data,bigdata,ai,technology,opportunism,leadership,trump,donaldtrump,control,artificialintelligence,aicontrol,power,political,politicalcartoon,editorialcartoon,meta,markzuckerberg,elonmusk,socialmedia,censorship,freespeech,fakenews,internet,money,business,monopoly,capitalism,neocapitalism,digitaldevices,data,bigdata,ai,technology,opportunism,leadership,trump,donaldtrump,control,artificialintelligence,aicontrol,power,political,politicalcartoon,editorialcartoon

Toilet

#456133 / viewed 1957 times
Enrico Bertuccioli By Enrico Bertuccioli
on January 09, 2025
rating-star 6
Applause
favorite
Favorite
report spam
Report

No fact checkers allowed...

Politics »  National/Domestic  International  Elections  Military & Security  Terrorism  Finances  Economy & Money  Technology  Family & Youth  Education  Fraud & Corruption  Historical  Other  Conflicts & War  Politicians  Parties  Privacy & Customer  Democracy  Energy

metamarkzuckerbergelonmusksocialmediacensorshipfreespeechfakenewsinternetmoneybusinessmonopolycapitalismneocapitalismdigitaldevicesdatabigdataaitechnologyopportunismleadershiptrumpdonaldtrumpcontrolartificialintelligenceaicontrolpowerpoliticalpoliticalcartooneditorialcartoonmetamarkzuckerbergelonmusksocialmediacensorshipfreespeechfakenewsinternetmoneybusinessmonopolycapitalismneocapitalismdigitaldevicesdatabigdataaitechnologyopportunismleadershiptrumpdonaldtrumpcontrolartificialintelligenceaicontrolpowerpoliticalpoliticalcartooneditorialcartoon

Collections

(1)
Political Cartoons - International!

Comments (8)

Add comment  
Enrico Bertuccioli
Member
MorituruS wrote:
The Age of Enlightenment was much more advanced than the post-factual age...*****

Sure MorituruS.

Enrico Bertuccioli, on January 09, 2025  report post  reply applause 0

 
Enrico Bertuccioli
Member
Harm Bengen wrote:
very good!

Many thanks Harm.

Enrico Bertuccioli, on January 09, 2025  report post  reply applause 0

 
Enrico Bertuccioli
Member
Erl wrote:
For big shitstorms!

Yes Erl.

Enrico Bertuccioli, on January 09, 2025  report post  reply applause 0

 
Enrico Bertuccioli
Member
leopold maurer wrote:
super!*****!

Thanks a lot Leopold.

Enrico Bertuccioli, on January 09, 2025  report post  reply applause 0

 
MorituruS
Member
The Age of Enlightenment was much more advanced than the post-factual age...*****

MorituruS, on January 09, 2025  report post  reply applause 0

 
Harm Bengen
Member
very good!

Harm Bengen, on January 09, 2025  report post  reply applause 0

 
Erl
Member
For big shitstorms!

Erl, on January 09, 2025  report post  reply applause 0

 
leopold maurer
Member
super!*****!

leopold maurer, on January 09, 2025  report post  reply applause 0

 
 

Add comment
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

More of Enrico Bertuccioli


Cartoon: Rearm Europe (small) by Enrico Bertuccioli tagged europe,eu,rearmeurope,armedeurope,military,security,defence,europeandefence,defencespending,europeandefencespending,weapons,arms,armsbusiness,armstrade,money,economy,armsindustry,worldwar,deadlyweapons,political,politicalcartoon,editorialcartoon
Rearm Europe
Cartoon: The claw of big tech (small) by Enrico Bertuccioli tagged world,newworldorder,technology,bigtech,technologicaldomain,domain,data,bigdata,power,control,neocapitalism,capitalism,technologicalcapitalism,digital,digitalcapitalism,money,business,economy,greed,dictatorship,political,politicalcartoon,editorialcartoon
The claw of big tech
Cartoon: Trump vs the communist Mamdani (small) by Enrico Bertuccioli tagged trump,donaldtrump,mamdani,zohranmamdani,newyork,mayoralelections,newyorkmayoralelections,federalfunds,fundscuts,democracy,usconstitution,communist,communism,socialism,socialdemocracy,equality,disequality,welfare,rich,poor,richness,poorness,political,politicalcartoon,politicalcartoons,editorialcartoon,editorialcartoons
Trump vs the communist Mamdani
  • Service

  • ToonAgent
  • Help
  • FAQ
  • Daily Toon
  • About Us

  • About Us
  • Contact
  • Terms of Use
  • Privacy Policy
  • Manage cookies
  • Community

  • Community
  • Pro search
  • Collections
  • Register
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie settings

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.