toonpool logo
  • Agent
  • Collections
  • more
    • Community
    • Members
    • Pro search
    • Help
  • Log In




    • Password lost?
  • Register
  • english
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Newest cartoons
Cartoon: Wertschöpfungskette (medium) by Erwin Pischel tagged wertschoepfungskette,corona,pandemie,sars,cov,epidemie,wertkette,kettenreaktion,value,chain,produktion,werte,wertschoepfung,betriebswirtschaft,marketing,vertrieb,wuhan,china,viren,schuppentier,artensterben,tierart,pischel,global,mitteltemperatur,klimaschutz,organigramm,temperatur,rezession,wirtschaft,kohlendioxid,kohlenstoffdioxid

Wertschöpfungskette

#354391 / viewed 4456 times
Erwin Pischel By Erwin Pischel
on March 13, 2020
rating-star 0
Applause
favorite
Favorite
report spam
Report

Geht doch!

Nature »  Environment  Evolution  Animals  Endangered Animals  Planet Earth  Climate  Natural Disasters  Nature Protection  Epidemics  Microbiology  Human  Genetics

wertschoepfungskettecoronapandemiesarscovepidemiewertkettekettenreaktionvaluechainproduktionwertewertschoepfungbetriebswirtschaftmarketingvertriebwuhanchinavirenschuppentierartensterbentierartpischelglobalmitteltemperaturklimaschutzorganigrammtemperaturrezessionwirtschaftkohlendioxidkohlenstoffdioxid

Comments (0)

Add comment  
 

More of Erwin Pischel


Cartoon: Gedächtnislü ke (small) by Erwin Pischel tagged gedächtnislücke,gedächtnis,amnesie,gedächtnisverlust,gedächtnisstörung,gehirn,filmriss,blackout,schädelhirntrauma,gehirnerschütterung,epilepsie,meningitis,enzephalitis,steckverbindung,netzstecker,gerätestecker,reisestecker,adapter,steckdose,strom,spannung,elektrische,leitung,kabel,gesicht,gesichtsprofil,profil,pischel
Gedächtnislü ke
Cartoon: The show must go on! (small) by Erwin Pischel tagged corona,covid,sars,delta,omega,variante,begrüßung,gruß,hand,handschlag,virus,impfung,immun,immunsystem,immunschutz,viren,antigen,virusoberfläche,epidemie,pandemie,geimpfter,ungeimpfter,immunabwehr,gefahr,alphabet,griechisch,pcr,covidtest,test,inzidenz,intensivstation,seuche,pischel
The show must go on!
Cartoon: China zensiert Google I (small) by Erwin Pischel tagged china,google,zensur,meinungsfreiheit,pischel
China zensiert Google I
  • Service

  • ToonAgent
  • Help
  • FAQ
  • Daily Toon
  • About Us

  • About Us
  • Contact
  • Terms of Use
  • Privacy Policy
  • Manage cookies
  • Community

  • Community
  • Pro search
  • Collections
  • Register
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie settings

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.