toonpool logo
  • Agent
  • Collections
  • more
    • Community
    • Members
    • Pro search
    • Help
  • Log In




    • Password lost?
  • Register
  • english
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Newest cartoons
Cartoon: wahlkampf (medium) by bob schroeder tagged wahlkampf,wahlplakat,partei,wahl,abstimmung,slogan

wahlkampf

#207641 / viewed 2617 times
bob schroeder By bob schroeder
on September 08, 2013
rating-star 0
Applause
favorite
Favorite
report spam
Report

.

Politics »  National/Domestic  Elections  Other  Politicians  Parties  Democracy

wahlkampfwahlplakatparteiwahlabstimmungslogan

Portfolios

(1)
fahklumpt

Comments (0)

Add comment  
 

More of bob schroeder


Cartoon: top_Monica29 Plugin (small) by bob schroeder tagged plugin,extension,optimierung,feature,update,ai,ki,sprachassistent
top_Monica29 Plugin
Cartoon: Ypidemi Virtual Shopping (small) by bob schroeder tagged virtual,shopping,3d,mall,virtuell,einkaufen,shop,ypidemi,avatar,comic
Ypidemi Virtual Shopping
Cartoon: top_Monica29 Selbsttest (small) by bob schroeder tagged corona,covid19,selbsttest,infektion,antigen,test,schnelltest,anwender,impfung,termin,user,ai,ki
top_Monica29 Selbsttest
  • Service

  • ToonAgent
  • Help
  • FAQ
  • Daily Toon
  • About Us

  • About Us
  • Contact
  • Terms of Use
  • Privacy Policy
  • Manage cookies
  • Community

  • Community
  • Pro search
  • Collections
  • Register
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2025 toonpool.com GmbH
Cookie settings

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.